PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009595924.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 242aa    MW: 27417.1 Da    PI: 7.9001
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009595924.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.21.4e-32168226159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh+
  XP_009595924.1 168 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHS 226
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.6E-34153226IPR003657WRKY domain
SuperFamilySSF1182903.79E-29160227IPR003657WRKY domain
PROSITE profilePS5081129.884163228IPR003657WRKY domain
SMARTSM007746.5E-38168227IPR003657WRKY domain
PfamPF031062.9E-25169225IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MERGEERELN NYDLQVSFSA PPSHANNIHD LGFVHFADHN QMMSFLAPPS SHSQLSSQLP  60
QPLQAAATTT VTPPTTTTNA TVAAASNNIS SALGFNHNEL VNRPSWNNNQ VETLDPKIVN  120
DENCSGNASE GNNSWWKNSS SDKGKVKIRR KLREPRFCFQ TRSDIDVLDD GYKWRKYGQK  180
VVKNSLHPRS YYRCTHSNCR VKKRVERLSE DCRMVITTYE GRHNHSPSDD SNSSEHDCFT  240
SF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-26159225874Probable WRKY transcription factor 4
2lex_A2e-26159225874Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146152KIRRKLR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBMTransfer from AT2G44745Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755131e-66HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009595924.10.0PREDICTED: probable WRKY transcription factor 12
SwissprotQ93WY41e-72WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A0S3SVH61e-107A0A0S3SVH6_PHAAN; Uncharacterized protein
STRINGSolyc01g089960.2.11e-105(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA73362029
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.13e-52WRKY family protein